Storage stability raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2025-11-03 and is reviewed periodically as new material appears.
Stability programs monitor lyophilized products under defined temperature and humidity conditions over time. Real-time studies at recommended storage conditions are the reference, while accelerated studies provide early signals of degradation pathways. Because a dry cake can still undergo oxidation, hydrolysis, or aggregation, stability depends on residual moisture, excipients, and container headspace. Open questions include how best to predict long-term stability from short accelerated runs and how vial-to-vial variability affects shelf life. Current guidance treats these predictions as product-specific rather than universally generalizable.
Freeze-dried materials are hygroscopic to varying degrees and can take up moisture after drying. Storage therefore often uses sealed glass vials, rubber stoppers, and crimp seals to limit contact with ambient humidity. A desiccant may be included for moisture-sensitive products, although it is not universal. Controlled room temperature is sufficient for many lyophilizates, while others require refrigeration or freezing. Moisture ingress remains a primary cause of cake collapse, chemical degradation, and loss of reconstitution performance.
Regulatory expectations for lyophilized products focus on consistent manufacture and documented stability. Batches are often monitored for moisture, appearance, potency, and sterility where applicable. Process parameters such as shelf temperature, chamber pressure, and drying time are recorded and controlled within validated ranges. Open questions remain about how best to predict long-term stability from short accelerated studies, especially for complex biologics. Variations in freezing rate and ice crystal size can produce differences that are not always visible but may affect performance.
After drying, a lyophilized product is usually sealed under vacuum or an inert gas to limit moisture uptake. Residual water content is measured because small changes can alter chemical stability and cake appearance. Storage temperature depends on the material; many biological products are kept at 2–8 °C, while some require −20 °C or colder. Exposure to ambient humidity during handling can cause the porous solid to absorb water and collapse. Container closures and stoppers are therefore selected for low moisture transmission and compatibility.
| Property | Value | Notes |
|---|---|---|
| Cake appearance | Uniform porous plug | Cracks, shrinkage, or meltback suggest process deviation. |
| Reconstitution time | 10 seconds to 5 minutes | Depends on cake structure, diluent, and agitation. |
| Typical storage humidity | Below 60% relative humidity | Lower humidity limits moisture uptake by hygroscopic cakes. |
| Container closure | Glass vial, elastomer stopper, crimp seal | Seal integrity limits moisture and oxygen ingress. |
| Common moisture test | Karl Fischer titration | Measures residual water content in the dried solid. |
Analytical methods for lyophilized solids must account for the low moisture content and the fragile cake. Karl Fischer titration is widely used for water content, while near-infrared spectroscopy can measure moisture non-destructively in sealed containers. X-ray diffraction and modulated differential scanning calorimetry help identify crystalline or amorphous phases. Residual solvent analysis may be needed if organic solvents were used during formulation. The combination of these methods supports batch release and long-term stability assessment.
Lyophilized products are typically stored as sealed solids in vials or syringes. Moisture ingress is a major concern because many dried cakes are hygroscopic and can lose stability when exposed to humid air. Storage temperature depends on the formulation; some products are kept refrigerated, while others are stable at room temperature. Container closure integrity and headspace moisture are often monitored. Light protection may also be required for some photosensitive materials.
Quality control for lyophilized materials includes visual inspection, residual moisture measurement, and reconstitution testing. Cake appearance can reveal process problems such as collapse, shrinkage, or meltback, although appearance alone does not prove potency. Residual moisture is commonly measured by Karl Fischer titration or by loss on drying. Reconstitution time is checked because a slow or incomplete dissolve can indicate a change in pore structure. Stability studies track these attributes over time under defined temperature and humidity conditions.
Handling and storage practices aim to keep the cake intact and dry. Vials are typically stored upright at controlled temperatures, often between 2 °C and 8 °C or at -20 °C for longer-term use. Reconstitution involves adding a suitable diluent and gently mixing until the solid dissolves. Shaking or rapid injection of diluent can create foam or damage sensitive molecules. Once reconstituted, the product may require refrigeration and use within a defined period.
Residual moisture is a key quality attribute for lyophilized products. Water that remains after secondary drying can affect chemical stability, cake structure, and shelf life. Karl Fischer titration is a common method for measuring water content in the dried solid. The target range varies by product, but many biologics are dried to between 0.5% and 3% water by weight. Acceptable limits are set during development and confirmed by stability studies.
Stability studies examine how temperature, humidity, and time influence a lyophilized product. Accelerated conditions provide early information about degradation pathways, while long-term studies support shelf-life claims. The glass transition temperature of the dried formulation can indicate its physical stability, and storage above this temperature may increase molecular mobility and lead to collapse or aggregation. Container closure integrity also matters because moisture or oxygen ingress can degrade the product, so vial stoppers and seals are part of the quality system.
Storage stability depends on water content, oxygen exposure, and temperature. Lyophilized solids are hygroscopic and can absorb water if exposed to humid air. Vials are usually sealed under vacuum or inert gas with rubber stoppers and aluminum crimps. Storage temperatures range from room temperature to refrigerated or frozen conditions depending on the material. Stability studies track potency, moisture, and physical form over time. Accelerated conditions can reveal sensitivity but may not predict long-term behavior.
Analytical methods for lyophilized materials include X-ray diffraction for crystallinity, differential scanning calorimetry for thermal transitions, and scanning electron microscopy for pore morphology. Moisture sorption analysis shows how the cake responds to humidity. These methods help distinguish amorphous from crystalline states and detect phase changes. Open questions remain about how pore structure changes during long-term storage and how best to predict collapse under varied conditions. Comparisons across studies are complicated by differences in formulation, cycle, and storage history.
Quality control for lyophilized products focuses on appearance, moisture level, reconstitution time, and structural integrity. A cake should be uniform, intact, and free of meltback or collapse. Moisture level is measured by Karl Fischer titration or thermogravimetric analysis. Reconstitution time reflects pore structure and formulation. Visual inspection and vial integrity checks detect cracks, stopper defects, or particulate matter. These checks are often performed on samples from each batch. They help confirm that the drying cycle performed as intended.
Lyophilized solids are often hygroscopic, so handling occurs in controlled low-humidity areas or glove boxes when the material is exposed. Vials remain sealed with elastomeric stoppers and aluminum crimps until use, because airborne moisture can raise residual water and shorten shelf life. The porous cake is fragile and may crack, shrink, or powder during transport. Personnel typically avoid repeated warming and cooling of sealed units, which can draw moisture through closures. These practices aim to preserve the low water content achieved during drying.
Storage conditions depend on the formulation and the intended shelf life. Many pharmaceutical and biological freeze-dried products are kept at 2–8 °C, while some stable foods and reagents tolerate room temperature. Others require −20 °C or colder to slow chemical degradation or aggregation. Protection from light and oxygen is common because oxidation can continue in the dry state. Stability studies usually monitor potency, appearance, moisture, and reconstitution time over months or years. Predictions from accelerated studies are useful but may not fully capture real-time changes.
Supervised injection sites are legally sanctioned, medically supervised facilities designed to provide a safe, hygienic, and stress-free environment for people who use substances. The facilities provide sterile injection equipment, information about substances and basic health care, treatment referrals, and access to medical staff. Opioid agonist therapy (OAT) is the medical procedure of using a harm-reducing opioid that produces significantly less euphoria, such as methadone or buprenorphine to reduce opioid cravings in people who use illegal opioids, such as heroin; buprenorphine and methadone are taken under medical supervision. Another approach is heroin assisted treatment, in which medical prescriptions for pharmaceutical heroin (diacetylmorphine) are provided to people who are dependent on heroin. Media campaigns inform drivers of the dangers of driving drunk. Most people who recreationally consume alcohol are now aware of these dangers and safe ride techniques like 'designated drivers' and free taxicab programmes are reducing the number of drunk-driving crashes. Many schools now provide safer sex education to teen and pre-teen students, who may engage in sexual activity. Since some adolescents are going to have sex, a harm-reductionist approach supports a sexual education which emphasizes the use of protective devices like condoms and dental dams to protect against unwanted pregnancy and the transmission of STIs. Since 1999, some countries have legalized or decriminalized prostitution, such as Germany (2002) and New Zealand (2003).
== Nutritional aspects == Significant elements of the nutritional science of fish protein powders centers around the bioactive and antioxidant properties of the peptide fractions produced during hydrolysis and their ability to have a positive impact on many conditions including gastrointestinal issues associated with irritable bowel syndrome (IBS) and Crohn's disease - as well reduction effects on hypertension and fast absorption functionality promotes the addition of lean muscle mass to humans consuming the products. Further studies showed that peptides in fish protein powders can minimize injurious effects of anti-inflammatory pain drugs. The University of Maryland School of Medicine concluded that certain peptide fractions from fish may inhibit prostate cancer and possibly other cancers from spreading. Additional benefits of fish protein powders are centered around diet needs of various subsets of the human population. Individuals who have lactose intolerance, milk allergy, gluten intolerance or coeliac disease (aka Celiac's) require alternate protein sources. The hydrolyzed nature of fish protein powder (low molecular weight profile) leads it to be used in hypoallergenic applications such as infant formulas. There is no evidence that infants who have a high risk of having an allergy to cows milk should be fed hydrolyzed infant formula instead of breast milk for allergy prevention.
The conquest of Armanum (location unknown but proposed as Tall Bazi) with its ruler Rid-Adad and Ebla (55 kilometers southwest of modern Aleppo) by Naram-Sin (Ebla was also defeated by his grandfather Sargon) is known from one of his year names "The year the king went on a campaign in Amarnum" and from an Old Babylonian copy of a statue inscription (IM 85461) found at Ur. There are also three objects, a marble lamp, a stone plaque, and a copper bowl, inscribed "Naram-Sin, the mighty, king of the four quarters, conqueror of Armanum and Ebla.". In 2010 a new stele fragment (IM 221139) describing the campaign was found at Tulul al-Baqarat (thought to be the ancient city of Kesh.
In 1924, Hahn was elected to full membership of the Prussian Academy of Sciences in Berlin, by a vote of thirty white balls to two black. While still remaining the head of his own department, he became Deputy Director of the KWIC in 1924, and succeeded Alfred Stock as the director in 1928. Meitner became the director of the Physical Radioactivity Division, while Hahn headed the Chemical Radioactivity Division. In the early 1920s, Hahn created a new line of research. Using the "emanation method", which he had recently developed, and the "emanation ability", he founded what became known as "applied radiochemistry" for the researching of general chemical and physical-chemical questions. In 1936 Cornell University Press published a book in English (and later in Russian) titled Applied Radiochemistry, which contained the lectures given by Hahn when he was a visiting professor at Cornell University in Ithaca, New York, in 1933. This publication had a major influence on almost all nuclear chemists and physicists in the United States, the United Kingdom, France, and the Soviet Union during the 1930s and 1940s. Hahn is referred to as the father of nuclear chemistry, which emerged from applied radiochemistry.
== Efforts to characterize all human cell types == Several efforts have been made to make a list or a map of all human cells. One of the largest and most recent is the HuBMAP (Human BioMolecular Atlas Program). The HuBMAP project has organized 1551 different samples in 17 collections, each dedicated to a different system. However, this project still only mapped about 31 of the human body's 70 organs. Their datasets and visualisations place great emphasis on biomarkers and location in the body, but less on cell development and how cells can change over time. Usually specific surface proteins are used to identify cells, and based on this they are put into different categories. Another major effort to make an overview of these proteins that allows us to observe cell types is the Human Protein Atlas. A similar project, the Human Brain Project has also attempted to map the human brain, although much of the publicly accessible model does not have cellular resolution.
Sources: en.wikipedia.org
SPECIAL obtains spatial localization from only a single dimension with pre-excitation inversion pulses (cycled on and off every other repetition time [TR]), making it a two-cycle sequence. The use of the preinversion pulse to remove one refocusing pulse (as compared with PRESS) is what allows SPECIAL to achieve a short TE, reaching a minimum of 2.2 msec on a preclinical scanner in rat brain while being able to recover the full signal and as low as 6 msec on a clinical 3T scanner. The largest drawback of SPECIAL and SPECIAL-sLASER is that they are two-cycle schemes, and systematic variations between cycles will manifest in their difference spectrum. Lipid contamination is a particularly large problem with SPECIAL and similar sequences. The state-of-the-art localization sequence is sLASER, which utilizes two pairs of adiabatic refocusing pulses. This has recently been recommended by consensus. The first is through OVS, which will reduce the contamination of lipid signals that originate from outside the voxel, although this comes at the cost of an increase in SAR. The second is not to set the amplitude of the pre-excitation inversion pulse to zero every other TR, but instead to shift the location of this ISIS plane such that the excited volume for the off condition is outside the object. This has been shown to greatly reduce lipid contamination, speculated to have arisen from the interaction between the RF pulse and lipid compartments due to incomplete relaxation, magnetization transfer, or the homonuclear Overhauser effect, although the exact mechanism remains unknown.
Offshore Group Newcastle make oil platforms. Sage Group, who produce accounting software, are based at Hazlerigg at the northern end of the Newcastle bypass. Northern Rock, which became a bank in 1997 and was taken over by Virgin Money in November 2011, and the Newcastle Building Society are based in Gosforth. The Gosforth-based bakery Greggs now has over 1,500 shops. The Balliol Business Park in Longbenton contains Procter & Gamble research and global business centres and a tax credits call centre for HMRC, and is the former home of Findus UK. The Government National Insurance Contributions Office in Longbenton, demolished and replaced in 2000, had a 1 mile (1.6 km) long corridor. Be-Ro and the Go-Ahead Group bus company are in central Newcastle. Nestlé use the former Rowntrees chocolate factory on the east of the A1. BAE Systems Land & Armaments in Scotswood, formerly Vickers-Armstrongs, is the main producer of British Army tanks such as the Challenger 2. A Rolls-Royce apprentice training site is next door. Siemens Energy Service Fossil make steam turbines at the CA Parsons Works in South Heaton. Sir Charles Parsons invented the steam turbine in 1884, and developed an important local company. Domestos, a product whose main ingredient is sodium hypochlorite, was originated in Newcastle in 1929 by William Handley, and was distributed from the area for many years. Clarke Chapman is next to the A167 in Gateshead. The MetroCentre, the largest shopping centre in Europe, is in Dunston.
Experimental research and computer modeling indicate that the surfaces of mineral particles inside hydrothermal vents have similar catalytic properties to enzymes and are able to create simple organic molecules, such as methanol (CH3OH) and formic acid (HCO2H), out of the dissolved CO2 in the water. Additionally, the discovery of supercritical CO2 at some sites has been used to further support the theory of hydrothermal origin of life given that it can increase organic reaction rates. Its high solvation power and diffusion rate allow it to promote amino and formic acid synthesis, as well as the synthesis of other organic compounds, polymers, and the four amino acids: alanine, arginine, aspartic acid, and glycine. In situ experiments have revealed the convergence of high N2 content and supercritical CO2 at some sites, as well as evidence for complex organic material (amino acids) within supercritical CO2 bubbles. Proponents of this theory for the origin of life also propose the presence of supercritical CO2 as a solution to the "water paradox" that pervades theories on the origin of life in aquatic settings. This paradox encompasses the fact that water is both required for life and will, in abundance, hydrolyze organic molecules and prevent dehydration synthesis reactions necessary to chemical and biological evolution. Supercritical CO2, being hydrophobic, acts as a solvent that facilitates an environment conducive to dehydration synthesis.
== Eli Lilly and Company == Ashkenazi spent 23 years in Eli Lilly in finance positions for several departments including as CFO of the global oncology division, the global diabetes division and the Lilly Research Laboratories overall, before becoming CFO for Eli Lilly and Company During Ashkenazi's tenureship as CFO, Eli Lilly successfully introduced a line of GLP-1 agonists based on tirzepatide under the brand names Mounjaro and Zepbound, which were immensely popular and financially successful. As CFO, Ashkenazi took steps to massively scale up production of these medications to ensure capacity matched demand.
does not necessarily reflect the intermolecular forces between the molecules, it is the energy cost associated with disrupting the pattern and may be thought of as a region where optimum arrangement does not occur and the reduction of enthalpy associated with ideal self-assembly did not occur. An example of this can be seen in a system of hexagonally packed cylinders where defect regions of lamellar structure exist. If
Sources: en.wikipedia.org
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
==== Labour and Employment, 2026-2028 ==== Lad is Inducted as Labour and Employment Minister of DK Shivakumar's Cabinet after reconstitution of Karnataka in 2026. He is also entrusted with responsibility of overseeing Dharwad District as In charge Minister.
After a period of rest and recovery, Zita found herself regularly going back to Europe for the weddings of her children. She decided to move back to the continent full-time in 1952 to Luxembourg to look after her aging mother. Maria Antonia died at the age of 96 in 1959. The bishop of Chur proposed to Zita that she move into a residence that he administered (formerly a castle of the Counts de Salis) at Zizers, Graubünden in Switzerland. As the castle had enough space for visits from her large family and a nearby chapel (a necessity for the devoutly-Catholic Zita), she accepted with ease. Zita occupied herself in her final years with her family. Although the restrictions on the Habsburgs entering Austria had been lifted, that applied only to those born after 10 April 1919. That meant that Zita could not attend the funeral of her daughter Adelheid in 1971, which was painful for her. She also involved herself in the efforts to have her deceased husband, the "Peace Emperor" canonised. In 1982, the restrictions were eased, and she returned to Austria after being absent for six decades. Over the next few years, the Empress made several visits to her former Austrian homeland and even appeared on Austrian television. In a series of interviews with the Viennese tabloid newspaper Kronen Zeitung, Zita expressed her belief that the deaths of Crown Prince Rudolf of Austria and his mistress Baroness Mary Vetsera, at Mayerling, in 1889, were not a double suicide but rather murder by French or Austrian agents.
=== Meiosis === Meiotic recombination in D. melanogaster appears to be employed in repairing damage in germ-line DNA as indicated by the findings that meiotic recombination is induced by the DNA damaging agents ultraviolet light and mitomycin C.
This interpretation remained controversial until NMR techniques demonstrated information transfer between hydrogen-bonded nuclei, a feat that would only be possible if the hydrogen bond contained some covalent character.
Sources: en.wikipedia.org
Many dried cakes are hygroscopic and can adsorb water during storage or handling. Absorbed moisture may lower the glass transition temperature and promote chemical reactions. Sealed packaging and controlled humidity reduce this risk.
Cake collapse usually means the product became too warm during the drying cycle. The dried matrix loses porosity and may appear shrunken or glassy. Collapse can slow reconstitution and may signal altered stability, though not every collapsed cake fails specifications.
Karl Fischer titration is a common method for measuring residual water in lyophilized solids. Loss on drying and thermogravimetric analysis are also used in some settings. The chosen method should be validated for the specific formulation and moisture range.
Most are held in sealed containers at controlled temperatures, often 2–8 °C, while some require frozen storage. Protection from moisture and light helps preserve the dry matrix. Exact conditions are set by the manufacturer or study protocol.