A practical reference on Residual moisture: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-10-18. Anything still debated is marked as such rather than presented as settled.
Storage conditions depend on the formulation and the intended shelf life. Many pharmaceutical and biological freeze-dried products are kept at 2–8 °C, while some stable foods and reagents tolerate room temperature. Others require −20 °C or colder to slow chemical degradation or aggregation. Protection from light and oxygen is common because oxidation can continue in the dry state. Stability studies usually monitor potency, appearance, moisture, and reconstitution time over months or years. Predictions from accelerated studies are useful but may not fully capture real-time changes.
Quality control for freeze-dried lots combines visual inspection with instrumental tests. Cake appearance, color, and shrinkage are recorded against a reference, while residual moisture is measured by Karl Fischer titration or loss on drying. Thermal analysis can reveal phase transitions and crystallization events, and X-ray diffraction distinguishes amorphous from crystalline solids. Microbiological tests and container closure integrity checks are also routine for sterile products. Analytical methods must be validated for the matrix, because excipients and low moisture can affect accuracy. Open questions include how best to predict long-term stability from short-term data.
Lyophilized solids are often hygroscopic, so handling occurs in controlled low-humidity areas or glove boxes when the material is exposed. Vials remain sealed with elastomeric stoppers and aluminum crimps until use, because airborne moisture can raise residual water and shorten shelf life. The porous cake is fragile and may crack, shrink, or powder during transport. Personnel typically avoid repeated warming and cooling of sealed units, which can draw moisture through closures. These practices aim to preserve the low water content achieved during drying.
Lyophilization is a drying process in which a solvent, usually water, is removed from a frozen material by sublimation under reduced pressure. The material is first solidified, then placed under vacuum so that ice transitions directly to vapor without a bulk liquid phase. This approach suits heat-sensitive substances that would degrade during conventional evaporation. Primary drying removes unbound ice, while secondary drying reduces water that remains adsorbed to the solid matrix. The result is a porous, lightweight solid that can be reconstituted later.
A typical cycle begins with freezing, sometimes including an annealing step to control ice crystal size. Freezing conditions influence the pore network that later allows vapor escape. During primary drying, shelf temperature and chamber pressure are set so heat enters the product while its temperature stays below the collapse or eutectic point. Secondary drying then raises the shelf temperature to desorb bound water and lower residual moisture. Cycle design depends on formulation, fill volume, container type, and equipment capability.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | 2–8 °C | Some products tolerate room temperature or require −20 °C. |
| Residual moisture method | Karl Fischer titration | Coulometric or volumetric; specific for water. |
| Cake appearance | Uniform porous plug | Collapse, shrinkage, or meltback indicates process deviation. |
| Reconstitution time | Seconds to several minutes | Depends on cake porosity, diluent, and formulation. |
| Primary container | Glass vial with elastomeric stopper | Crimp seal limits moisture ingress. |
Stability studies examine how temperature, humidity, and time influence a lyophilized product. Accelerated conditions provide early information about degradation pathways, while long-term studies support shelf-life claims. The glass transition temperature of the dried formulation can indicate its physical stability, and storage above this temperature may increase molecular mobility and lead to collapse or aggregation. Container closure integrity also matters because moisture or oxygen ingress can degrade the product, so vial stoppers and seals are part of the quality system.
Handling and storage practices aim to keep the cake intact and dry. Vials are typically stored upright at controlled temperatures, often between 2 °C and 8 °C or at -20 °C for longer-term use. Reconstitution involves adding a suitable diluent and gently mixing until the solid dissolves. Shaking or rapid injection of diluent can create foam or damage sensitive molecules. Once reconstituted, the product may require refrigeration and use within a defined period.
Residual moisture is a key quality attribute for lyophilized products. Water that remains after secondary drying can affect chemical stability, cake structure, and shelf life. Karl Fischer titration is a common method for measuring water content in the dried solid. The target range varies by product, but many biologics are dried to between 0.5% and 3% water by weight. Acceptable limits are set during development and confirmed by stability studies.
The physics of freeze-drying couples heat transfer, mass transfer, and phase change. Heat supplied through the shelf must reach the sublimation front without melting the ice or degrading the product. Water vapor then travels through the already dried layer and leaves the chamber, where low pressure and cold traps keep it from returning. The dried layer acts as a resistance to vapor flow, so drying rate changes as the front recedes. Open questions remain about how pore structure and formulation heterogeneity affect drying uniformity at larger scales.
Lyophilization removes water from a frozen material by sublimation under reduced pressure. The process begins with freezing, which converts liquid water into ice and concentrates dissolved solids. Primary drying then lowers chamber pressure so ice changes directly into vapor without passing through a liquid phase. Secondary drying raises the shelf temperature to remove bound water that remains after ice sublimation. The result is a dry, porous structure that can be reconstituted later.
Formulation composition influences whether freeze-drying produces an intact cake or a collapsed mass. Excipients such as sugars and polymers can raise the collapse temperature and provide bulk during drying. The critical temperature for primary drying is often the collapse temperature or the glass transition temperature of the maximally concentrated phase. If the product temperature exceeds this threshold, the frozen matrix may soften and lose structure. Established practice therefore links shelf temperature and chamber pressure to the formulation's thermal properties.
Regulatory expectations for lyophilized products focus on consistent manufacture and documented stability. Batches are often monitored for moisture, appearance, potency, and sterility where applicable. Process parameters such as shelf temperature, chamber pressure, and drying time are recorded and controlled within validated ranges. Open questions remain about how best to predict long-term stability from short accelerated studies, especially for complex biologics. Variations in freezing rate and ice crystal size can produce differences that are not always visible but may affect performance.
After drying, a lyophilized product is usually sealed under vacuum or an inert gas to limit moisture uptake. Residual water content is measured because small changes can alter chemical stability and cake appearance. Storage temperature depends on the material; many biological products are kept at 2–8 °C, while some require −20 °C or colder. Exposure to ambient humidity during handling can cause the porous solid to absorb water and collapse. Container closures and stoppers are therefore selected for low moisture transmission and compatibility.
Freezing is the first stage and sets the ice structure that later becomes the pore network. The formulation is cooled below its freezing point, often with a controlled ramp, and solutes concentrate as ice forms. Primary drying then lowers chamber pressure and supplies heat to sublime the ice. The product temperature must stay below its collapse or eutectic temperature to prevent structural loss. Secondary drying raises the temperature modestly to remove bound water and achieve a low residual moisture.
A freeze-dryer consists of a vacuum chamber, temperature-controlled shelves, a condenser, and a vacuum pump. Vials, ampoules, or bulk trays hold the product during the cycle. The condenser traps water vapor as ice at a temperature lower than the product. Cycle development balances shelf temperature, chamber pressure, and time. Scale-up can be difficult because heat and mass transfer change with equipment size, so process analytical tools and conservative validation are often used.
Lyophilization is a dehydration technique in which a product is frozen and the solvent is removed under reduced pressure. The low pressure allows ice to sublimate directly into vapor without passing through a bulk liquid phase. This differs from conventional drying, where heat drives evaporation and can damage heat-sensitive structures. The process is used for biological materials, pharmaceutical formulations, and some foods. Its main advantage is preservation of porous structure and rapid reconstitution.
Excitotoxicity Cell death caused by excessive stimulation by neurotransmitters such as glutamate, leading to calcium overload and neuronal damage. It is implicated in stroke and neurodegenerative diseases. Executive function A set of cognitive processes including working memory, flexible thinking, and self-control. Primarily associated with the prefrontal cortex. Exocytosis The process by which vesicles release their contents outside the cell. In neurons, it refers to the release of neurotransmitters into the synaptic cleft. Extracellular matrix A network of proteins and molecules outside cells
==== Physiological and metabolic consequences ==== OSA in adults is associated with a higher risk for cardiovascular morbidities, diabetes, hypertension, coronary artery disease and stroke – OSA might have a role in the etiology of these conditions. Those conditions may lead to increased mortality that an appropriate treatment for OSA may reduce. OSA is often linked with hypertension as it induces an increase in sympathetic activity that can lead to the elevation of blood pressure. The OSA-related hypercapnia has been suggested to be related to the development of hypertension. Treating the OSA may prevent the development of hypertension. The relationship between OSA and excess body weight is complex, as obesity is more prevalent amongst OSA patients but can also be a risk factor for the development of OSA – it accounts for 58% of adult cases. Thus, both OSA and obesity (when present) may work synergistically and lead to hyperlipidemia, diabetes, insulin resistance and other symptoms of the metabolic syndrome. The metabolic syndrome itself is often associated with OSA: 74–85% of OSA patients are diagnosed with it. CPAP therapy can lead to an improvement of some of the cardiovascular component of the metabolic syndrome while weight loss is also recommended for its positive effects on OSA consequences and metabolic dysfunctions. An intervention comprising exercise and diet is thus effective for the treatment of OSA as it positively impacts the severity of both obesity symptoms and OSA symptoms.
The LSD molecule has two chiral centers at carbons 5 and 8 of the ergoline ring system and hence there are four possible enantiomeric stereoisomers of LSD. Iso-LSD, also known as d-iso-LSD, (+)-iso-LSD, or (5R-8S)-LSD, is one of four possible stereoisomers. The other isomers are LSD (d-LSD, (+)-LSD, or (5R,8R)-LSD), l-iso-LSD ((–)-iso-LSD or (5S,8R)-iso-LSD), and l-LSD ((–)-LSD or (5S,8S)-LSD). None of them are known to have significant psychoactivity in humans besides LSD. LSD is easily epimerized into iso-LSD with base. Consequently, iso-LSD is a common synthetic contaminant in chemical synthesis of LSD. Iso-LSD can be easily epimerized back into LSD. LSD can degrade into iso-LSD depending on temperature, solvent and pH, among other factors. In clinical studies, up to 30% of LSD administered in capsules has been found to isomerize into iso-LSD. Iso-LSD is said to be a metabolite of LSD in animals and humans. However, according to other sources, iso-LSD not a metabolite of LSD but is instead only a contaminant.
Sources: en.wikipedia.org
==== 2500–2599 ==== Trade Union Reform and Employment Rights Act 1993 (Commencement No. 2 and Transitional Provisions) Order 1993 (S.I. 1993/2503) Combined Probation Areas (Dorset) Order 1993 (S.I. 1993/2512) Teachers' (Superannuation and Compensation for Premature Retirement) (Scotland) Amendment Regulations 1993 (S.I. 1993/2513) Coal Industry Act 1992 (Commencement) Order 1993 (S.I. 1993/2514) Export of Goods (Control) (Amendment No. 5) Order 1993 (S.I. 1993/2515) Friendly Societies (Qualifications of Actuaries No.2) Regulations 1993 (S.I. 1993/2518) Friendly Societies (Amendment) Regulations 1993 (S.I. 1993/2519) Friendly Societies (Insurance Business No. 2) Regulations 1993 (S.I. 1993/2520) Friendly Societies (Authorisation No. 2) Regulations 1993 (S.I. 1993/2521) A11 Trunk Road (Roudham Heath to Attleborough Improvement and Slip Roads) Order 1993 (S.I. 1993/2524) A11 Trunk Road (Roudham Heath to Attleborough Improvement) (Detrunking) Order 1993 (S.I. 1993/2525) Protection of Wrecks (Designation No. 2) Order 1993 (S.I. 1993/2526) Police (Amendment) (No. 4) Regulations 1993 (S.I. 1993/2527) Police Cadets (Amendment) Regulations 1993 (S.I. 1993/2528) Fodder Plant Seeds (Amendment) Regulations 1993 (S.I. 1993/2529) Seeds (Registration, Licensing and Enforcement) (Amendment) Regulations 1993 (S.I. 1993/2530) Local Government Superannuation (Maternity Absence) Regulations 1993 (S.I. 1993/2531) Sea Fisheries Districts (Variation) Order 1993 (S.I. 1993/2532) Suppression of Terrorism Act 1978 (Application of Provisions) (India) Order 1993 (S.I.
Clinicians use drug detoxification to reduce or relieve withdrawal symptoms while helping an addicted person adjust to living without drug use. Drug detoxification does not aim to treat addiction but rather represents an early step within long-term treatment. Detoxification may be achieved drug-free or may use medications as an aspect of treatment. Often drug detoxification and treatment will occur in a community program that lasts several months and takes place in a residential setting rather than in a medical center. Drug detoxification varies depending on the location of treatment, but most detox centers provide treatment to avoid the symptoms of physical withdrawal from alcohol and from other drugs. Most also incorporate counseling and therapy during detox to help with the consequences of withdrawal.
== Formation mechanism == Eukaryote ribosomes are produced and assembled in the nucleolus. Ribosomal proteins enter the nucleolus and combine with the four rRNA strands to create the two ribosomal subunits (one small and one large) that will make up the completed ribosome. The ribosome units leave the nucleus through the nuclear pores and unite once in the cytoplasm for the purpose of protein synthesis.
The abandonment of grazing has caused trees to encroach on many of these balds, threatening their ecosystems. In contrast to the largely grazing-influenced balds of the southern Appalachians, parts of the northern Appalachians such as the White Mountains. the Adirondack Mountains, and Mount Katahdin have summits covered with true alpine tundra; these ecosystems are kept clear due to extremely harsh winter storms, and support a vegetation community more akin to that of the Arctic Circle.
Sources: en.wikipedia.org
In addition to developing new medicines, the company achieved several technological advances, including the automation of its production facilities. Lilly was also an innovator in pill capsule manufacturing. It was among the first manufacturers to insert medications into empty gelatin capsules, which provided a more exact dosage. Lilly manufactured capsules for its own needs and sold its excess capacity to others. In 1917, Scientific American described Lilly as "the largest capsule factory in the world" and reported that the company was "capable of producing 2.5 million capsules a day". One of Lilly's early innovations was fruit flavoring for medicines and sugar-coated pills to make their medicines easier to swallow. Over the next few years, the company created tens of millions of capsules and pills annually. Other advances improved plant efficiency and eliminated production errors. In 1909, Eli Lilly, grandson of the company's founder, introduced a method for blueprinting manufacturing tickets, which created multiples copies of a drug formula and helped eliminate manufacturing and transcription errors. In 1920, Josiah hired biochemist George Henry Alexander Clowes as a research chemist; Clowes was promoted to director of biochemical research the following year. In the 1920s, Eli introduced the new concept of straight-line production to the pharmaceutical industry, where raw materials entered at one end of the facility and the finished product came out the other end, in the company's manufacturing process.
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
== Function == Agouti-related protein is expressed primarily in the adrenal gland, subthalamic nucleus, and hypothalamus, with lower levels of expression in the testis, kidneys, and lungs. The appetite-stimulating effects of AgRP are inhibited by the hormone leptin and activated by the hormone ghrelin. Adipocytes secrete leptin in response to food intake. This hormone acts in the arcuate nucleus and inhibits the AgRP/NPY neuron from releasing orexigenic peptides. Ghrelin has receptors on NPY/AgRP neurons that stimulate the secretion of NPY and AgRP to increase appetite. AgRP is stored in intracellular secretory granules and is secreted via a regulated pathway. The transcriptional and secretory action of AgRP is regulated by inflammatory signals. Levels of AgRP are increased during periods of fasting. It has been found that AgRP stimulates the hypothalamic-pituitary-adrenocortical axis to release ACTH, cortisol and prolactin. It also enhances the ACTH response to IL-1-beta, suggesting it may play a role in the modulation of neuroendocrine response to inflammation. Conversely, AgRP-secreting neurons inhibit the release of TRH from the paraventricular nucleus (PVN), which may contribute to conservation of energy in starvation. This pathway is part of a feedback loop, since TRH-secreting neurons from PVN stimulate AgRP neurons.
One theory says the submarine sandwich was brought to the U.S. by Dominic Conti (1874–1954), an Italian immigrant who came to New York in the late-19th century. He supposedly named it "submarine roll" after seeing the recovered 1901 submarine called Fenian Ram in the Paterson Museum of New Jersey in 1928. His granddaughter said:
Furthermore, it is possible to transplant freeze-dried donor tissue. The freeze-drying process ensures this tissue is dead, so there is no chance of rejection. Research from two trials in Iran provide low to moderate evidence that graft rejection is more likely to occur in penetrating keratoplasty than in DALK, though the likelihood for graft failure were similar with both procedures.
Sources: en.wikipedia.org
Karl Fischer titration is widely used because it is specific for water and works at low levels. Loss on drying is simpler but less specific, since volatile solvents or decomposition products can also be lost.
Collapse can occur when the product temperature exceeds its critical formulation temperature during drying. The porous structure then melts or shrinks, reducing reconstitution speed and sometimes altering stability.
No. Low moisture slows many degradation pathways but does not stop oxidation, hydrolysis, or physical changes completely. Storage temperature, container closure, and formulation still influence shelf life.
Freezing only converts liquid to solid. Lyophilization adds vacuum and controlled warming so frozen solvent sublimes, leaving a dry porous solid. The two steps are related but not interchangeable.