The short version of reconstitution time fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2025-10-30. Anything still debated is marked as such rather than presented as settled.
Stability programs monitor lyophilized products under defined temperature and humidity conditions over time. Real-time studies at recommended storage conditions are the reference, while accelerated studies provide early signals of degradation pathways. Because a dry cake can still undergo oxidation, hydrolysis, or aggregation, stability depends on residual moisture, excipients, and container headspace. Open questions include how best to predict long-term stability from short accelerated runs and how vial-to-vial variability affects shelf life. Current guidance treats these predictions as product-specific rather than universally generalizable.
Freeze-dried materials are hygroscopic to varying degrees and can take up moisture after drying. Storage therefore often uses sealed glass vials, rubber stoppers, and crimp seals to limit contact with ambient humidity. A desiccant may be included for moisture-sensitive products, although it is not universal. Controlled room temperature is sufficient for many lyophilizates, while others require refrigeration or freezing. Moisture ingress remains a primary cause of cake collapse, chemical degradation, and loss of reconstitution performance.
Freeze-drying is used for materials whose activity or structure depends on low temperature and low water content. Examples include certain biologics, diagnostic reagents, starter cultures, coffee, and porous inorganic precursors. The dried product forms a cake whose porosity aids rapid wetting and dissolution. Main drawbacks are high energy use, long cycle times, and sensitivity to formulation and equipment variation. Questions remain about how freezing rates and ice morphology affect batch uniformity, especially when moving from laboratory to production scale.
Lyophilization, also called freeze-drying, is a dehydration process in which a solvent, usually water, is frozen and then removed by sublimation under reduced pressure. The method preserves heat-sensitive materials that would degrade in conventional drying. Large-scale use grew during the mid-twentieth century for blood plasma and antibiotics, and it later expanded to vaccines, enzymes, foods, and advanced materials. The process produces a dry, porous solid that usually reconstitutes rapidly. It is distinct from simple evaporation because the solvent bypasses the liquid phase during primary removal.
| Property | Value | Notes |
|---|---|---|
| Cake appearance | Uniform porous plug | Cracks, shrinkage, or meltback suggest process deviation. |
| Reconstitution time | 10 seconds to 5 minutes | Depends on cake structure, diluent, and agitation. |
| Typical storage humidity | Below 60% relative humidity | Lower humidity limits moisture uptake by hygroscopic cakes. |
| Container closure | Glass vial, elastomer stopper, crimp seal | Seal integrity limits moisture and oxygen ingress. |
| Common moisture test | Karl Fischer titration | Measures residual water content in the dried solid. |
Handling and storage practices aim to keep the cake intact and dry. Vials are typically stored upright at controlled temperatures, often between 2 °C and 8 °C or at -20 °C for longer-term use. Reconstitution involves adding a suitable diluent and gently mixing until the solid dissolves. Shaking or rapid injection of diluent can create foam or damage sensitive molecules. Once reconstituted, the product may require refrigeration and use within a defined period.
Residual moisture is a key quality attribute for lyophilized products. Water that remains after secondary drying can affect chemical stability, cake structure, and shelf life. Karl Fischer titration is a common method for measuring water content in the dried solid. The target range varies by product, but many biologics are dried to between 0.5% and 3% water by weight. Acceptable limits are set during development and confirmed by stability studies.
Stability studies examine how temperature, humidity, and time influence a lyophilized product. Accelerated conditions provide early information about degradation pathways, while long-term studies support shelf-life claims. The glass transition temperature of the dried formulation can indicate its physical stability, and storage above this temperature may increase molecular mobility and lead to collapse or aggregation. Container closure integrity also matters because moisture or oxygen ingress can degrade the product, so vial stoppers and seals are part of the quality system.
The process relies on the phase diagram of water, where the triple point marks the conditions at which ice, liquid water, and vapor coexist. By maintaining pressure below this point, typically around 0.01 to 0.1 millibar, sublimation becomes the dominant mechanism. Formulations often include excipients such as sugars or polymers that act as lyoprotectants and bulking agents. These additives help preserve the structure of the active ingredient and prevent collapse during drying. The choice of excipient and freezing rate influences the final cake morphology and stability.
Industries use lyophilization for pharmaceuticals, biological products, and food preservation. In the pharmaceutical sector, it extends the shelf life of injectable drugs, vaccines, and proteins that are unstable in aqueous solution. Food manufacturers apply freeze-drying to coffee, fruits, and ready meals to retain flavor and texture. The process is energy-intensive and requires specialized equipment, which limits its use to high-value products. Ongoing research examines how formulation and process parameters affect the quality of the final dried product.
Lyophilization, also known as freeze-drying, is a process that removes water from a material by freezing it and then reducing pressure to allow ice to sublimate directly into vapor. The method begins with a freezing step that solidifies the water content. Next, primary drying lowers the pressure below the triple point of water, enabling sublimation without passing through a liquid phase. A final secondary drying step removes bound water through desorption. This sequence produces a dry, porous cake that can be reconstituted later.
After lyophilization, the dried product is often sealed under vacuum or an inert gas to limit moisture and oxygen exposure. Vials, stoppers, and seals must maintain their barrier throughout shelf life. Storage temperature depends on product sensitivity: some cakes tolerate controlled room temperature, while labile biologics require refrigeration. Humidity is a critical variable because dried cakes are hygroscopic and can absorb water when exposed to air. Handling procedures therefore limit open-vial time and use desiccated environments for sampling.
Quality control for lyophilized materials examines appearance, reconstitution time, residual moisture, and mechanical integrity. An acceptable cake is usually uniform and porous, though appearance alone does not prove stability. Karl Fischer titration is a common method for water content, while differential scanning calorimetry can reveal glass transition events. Stability studies track potency, aggregation, and moisture over time under defined temperature and humidity conditions. Specifications are product-specific and may include sterility and endotoxin tests for sterile preparations.
Lyophilization removes water from a frozen material by sublimation under reduced pressure. The process begins with freezing, which converts liquid water into ice and concentrates dissolved solids. Primary drying then lowers chamber pressure so ice changes directly into vapor without passing through a liquid phase. Secondary drying raises the shelf temperature to remove bound water that remains after ice sublimation. The result is a dry, porous structure that can be reconstituted later.
Formulation composition influences whether freeze-drying produces an intact cake or a collapsed mass. Excipients such as sugars and polymers can raise the collapse temperature and provide bulk during drying. The critical temperature for primary drying is often the collapse temperature or the glass transition temperature of the maximally concentrated phase. If the product temperature exceeds this threshold, the frozen matrix may soften and lose structure. Established practice therefore links shelf temperature and chamber pressure to the formulation's thermal properties.
The physics of freeze-drying couples heat transfer, mass transfer, and phase change. Heat supplied through the shelf must reach the sublimation front without melting the ice or degrading the product. Water vapor then travels through the already dried layer and leaves the chamber, where low pressure and cold traps keep it from returning. The dried layer acts as a resistance to vapor flow, so drying rate changes as the front recedes. Open questions remain about how pore structure and formulation heterogeneity affect drying uniformity at larger scales.
In the 2025 speculative fiction novel The Strange Case of Jane O. by Karen Thompson Walker, a New York City psychiatrist treats a hyperthymestic woman who has mysterious blackouts and hallucinations. In the 2025 romance novel The Survivor Wants to Die at the End by Adam Silvera, one of the protagonists, Alano Rosa, has hyperthymesia and can remember even before he was born. He relives every moment he remembers including feelings, which in some instances cause him physical pain.
Like labour regulation, European company law is not a complete system and there is no such thing as a self-standing European corporation. Instead, a series of Directives require minimum standards, usually protecting investors, to be implemented in national corporate laws. The largest in Europe remain member state incorporations, such as the UK "plc", the German "AG" or the French "SA". There is however, a "European Company" (or Societas Europaea, abbreviated to "SE") created by the Statute for a European Company Regulation 2001. This sets out basic provisions on the method of registration (e.g. by merger or reincorporation of an existing company) but then states that wherever the SE has its registered office, the law of that member state supplements the rules of the Statute. The Employee Involvement Directive 2001 also adds that, when an SE is incorporated, employees have the default right to retain all existing representation on the board of directors that they have, unless the negotiate by collective agreement a different or better plan than is provided for in existing member state law. Other than this, most important standards in a typical company law are left to member state law, so long as they comply with further minimum requirements in the company law directives. Duties owed by the board of directors to the company and its stakeholders, or the right to bring derivative claims to vindicate constitutional rights, are not generally regulated by EU law.
== External links == Anatomy photo: Digestive/mammal/system1/system10 - Comparative Organology at University of California, Davis - "Mammal, whole system (LM, Low)" Histology image: 55_07 at the University of Oklahoma Health Sciences Center (vermiform appendix)
=== Repetitive transcranial magnetic stimulation === Transcranial magnetic stimulation (TMS) or deep transcranial magnetic stimulation is a noninvasive method used to stimulate small regions of the brain. During a TMS procedure, a magnetic field generator, or "coil" is placed near the head of the person receiving the treatment. The coil produces small electric currents in the region of the brain just under the coil via electromagnetic induction. The coil is connected to a pulse generator, or stimulator, that delivers electric current to the coil. TMS was approved by the FDA for treatment-resistant major depressive disorder in 2008 and as of 2014 clinical evidence supports this use. The American Psychiatric Association, the Canadian Network for Mood and Anxiety Disorders, and the Royal Australia and New Zealand College of Psychiatrists have endorsed rTMS for trMDD. The response rate is about 29% for TRD patients. Remission rate is about 20%.
== Reception == Half a Life was enthusiastically received by critics in America and abroad. Writing in The Guardian, writer and critic Robert McCrum called the book "a masterpiece....'Half my life ago, I killed a girl'. You'll rarely get a better first line. What follows—Strauss's precise, honest and rigorous account of a fateful road accident and its harrowing aftermath—fulfills every hope aroused in the casual reader." In the Chicago Tribune, critic Elizabeth Taylor called it "a book that inspires admiration, sentence by sentence...This is memoir in its finest form." Writer Dani Shapiro, in The New York Times Book Review, found the memoir "elegant, painful, stunningly honest." She continued, "At the center of this memoir thrums a question fundamental to what it means to be human: What do we do with what we’ve been given?" A critical favorite in the UK, Half a Life was called "one of the best books I have ever read" by Ali Catterall on the BBC, as well as "precise, elegantly written, fresh, wise, and very sad ... indicative not only of a very talented writer, but of a proper human being” by Nick Hornby Half a Life was widely excerpted in venues such as GQ, This American Life, United Kingdom papers The Times and Daily Mail.
Sources: en.wikipedia.org
Colony-forming unit-fibroblast Mesenchymal stem cell / marrow stromal cell Chondrocyte Hypertrophic chondrocyte Mesenchymal (mesoderm origin) stem cells are undifferentiated, meaning they can differentiate into a variety of generative cells commonly known as osteochondrogenic (or osteogenic, chondrogenic, osteoprogenitor, etc.) cells. When referring to bone, or in this case cartilage, the originally undifferentiated mesenchymal stem cells lose their pluripotency, proliferate and crowd together in a dense aggregate of chondrogenic cells (cartilage) at the location of chondrification. These chondrogenic cells differentiate into so-called chondroblasts, which then synthesize the cartilage extracellular matrix (ECM), consisting of a ground substance (proteoglycans, glycosaminoglycans for low osmotic potential) and fibers. The chondroblast is now a mature chondrocyte that is usually inactive but can still secrete and degrade the matrix, depending on conditions. Cell culture studies of excess Vitamin B inhibits the synthesis of chondroitin sulfate by chondrocytes and causes the inhibition of chondrogenesis in the developing embryo which may result in limb malformations. Chondrocytes undergo terminal differentiation when they become hypertrophic, which happens during endochondral ossification. This last stage is characterized by major phenotypic changes in the cell.
== Research == Pseudoephedrine has been studied in the treatment of snoring. However, data are inadequate to support this use. A study has found that pseudoephedrine can reduce milk production in breastfeeding women. This might have been due to suppression of prolactin secretion. Pseudoephedrine might be useful for lactation suppression.
July 28 – August 4: 2018 Senior League Baseball World Series in Easley at Easley Recreation Complex The Pariba Little League (Caribbean) defeated the Naamans Little League (East), 7–2, in the final. July 29 – August 5: 2018 Little League Intermediate (50/70) Baseball World Series in Livermore at Max Baer Park The West Seoul LL (Asia-Pacific) defeated the Livermore/Granada LL (Host), 10–0, in the final. August 12 – 19: 2018 Junior League World Series in Taylor at Heritage Park The Shing-Ming Junior LL (Asia-Pacific) defeated the Lufkin LL (Southwest), 2–0, in the final. August 16 – 26: 2018 Little League World Series in South Williamsport at both the Little League Volunteer Stadium and the Howard J. Lamade Stadium The Honolulu LL (West) defeated the South Seoul LL (Asia-Pacific and Middle East), 3–0, in the final.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
== Formation and decay == The sum of the atomic mass of the two atoms produced by the fission of one fissile atom is always less than the atomic mass of the original atom. This is because some of the mass is lost as free neutrons, and once kinetic energy of the fission products has been removed (i.e., the products have been cooled to extract the heat provided by the reaction), then the mass associated with this energy is lost to the system also, and thus appears to be "missing" from the cooled fission products. Since the nuclei that can readily undergo fission are particularly neutron-rich (e.g. 61% of the nucleons in uranium-235 are neutrons), the initial fission products are often more neutron-rich than stable nuclei of the same mass as the fission product (e.g. stable zirconium-90 is 56% neutrons compared to unstable strontium-90 at 58%). The initial fission products therefore may be unstable and typically undergo beta decay to move towards a stable configuration, converting a neutron to a proton with each beta emission. (Most fission products do not decay via alpha decay.) A few neutron-rich and short-lived initial fission products decay by ordinary beta decay (this is the source of perceptible half-life, typically a few tenths of a second to a few seconds), followed by immediate emission of a neutron by the excited daughter-product. This process is the source of so-called delayed neutrons, which play an important role in control of a nuclear reactor. The first beta decays are rapid and may release high energy beta particles or gamma radiation.
Sources: en.wikipedia.org
Many dried cakes are hygroscopic and can adsorb water during storage or handling. Absorbed moisture may lower the glass transition temperature and promote chemical reactions. Sealed packaging and controlled humidity reduce this risk.
Cake collapse usually means the product became too warm during the drying cycle. The dried matrix loses porosity and may appear shrunken or glassy. Collapse can slow reconstitution and may signal altered stability, though not every collapsed cake fails specifications.
Karl Fischer titration is a common method for measuring residual water in lyophilized solids. Loss on drying and thermogravimetric analysis are also used in some settings. The chosen method should be validated for the specific formulation and moisture range.
Yes. Lyophilization and freeze-drying are synonyms for the same vacuum-assisted sublimation process. The term lyophilization is more common in pharmaceutical and laboratory settings, while freeze-drying is widely used in food and general contexts.